Ifng (Mouse) Recombinant Protein
  • Ifng (Mouse) Recombinant Protein

Ifng (Mouse) Recombinant Protein

Ref: AB-P8160
Ifng (Mouse) Recombinant Protein

Información del producto

Mouse Ifng (P01580, 22 a.a. - 155 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Ifng
Gene Alias IFN-g|IFN-gamma|Ifg
Gene Description interferon gamma
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 15978

Enviar uma mensagem


Ifng (Mouse) Recombinant Protein

Ifng (Mouse) Recombinant Protein