IFNG (Human) Recombinant Protein View larger

Human IFNG (P01579, 24 a.a. - 161 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P8159

New product

IFNG (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name IFNG
Gene Alias IFG|IFI
Gene Description interferon, gamma
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 3458

More info

Human IFNG (P01579, 24 a.a. - 161 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human IFNG (P01579, 24 a.a. - 161 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Human IFNG (P01579, 24 a.a. - 161 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.