Ifnar1 (Mouse) Recombinant Protein
  • Ifnar1 (Mouse) Recombinant Protein

Ifnar1 (Mouse) Recombinant Protein

Ref: AB-P8151
Ifnar1 (Mouse) Recombinant Protein

Información del producto

Mouse Ifnar1 (P33896, 27 a.a. - 429 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cell.
Información adicional
Size 2 x 10 ug
Gene Name Ifnar1
Gene Alias CD118|Ifar|Ifnar|Ifrc|Infar
Gene Description interferon (alpha and beta) receptor 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ENLKPPENIDVYIIDDNYTLKWSSHGESMGSVTFSAEYRTKDEAKWLKVPECQHTTTTKCEFSLLDTNVYIKTQFRVRAEEGNSTSSWNEVDPFIPFYTAHMSPPEVRLEAEDKAILVHISPPGQDGNMWALEKPSFSYTIRIWQKSSSDKKTINSTYYVEKIPELLPETTYCLEVKAIHPSLKKHSNYSTVQCISTTVANKMPVPGNLQVDAQGKSYVLKWDYIASADVLFRAQWLPGYSKSSSGSRSDKWKPI
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 15975

Enviar uma mensagem


Ifnar1 (Mouse) Recombinant Protein

Ifnar1 (Mouse) Recombinant Protein