IFNA2 (Human) Recombinant Protein View larger

Human IFNA2 (P01563, 24 a.a. - 188 a.a.) partial recombinant protein expressed in <i>Saccharomyces cerevisiae</i>.

AB-P8146

New product

IFNA2 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 100 ug
Gene Name IFNA2
Gene Alias IFNA|INFA2|MGC125764|MGC125765
Gene Description interferon, alpha 2
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRRDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 3440

More info

Human IFNA2 (P01563, 24 a.a. - 188 a.a.) partial recombinant protein expressed in Saccharomyces cerevisiae.

Enviar uma mensagem

Human IFNA2 (P01563, 24 a.a. - 188 a.a.) partial recombinant protein expressed in <i>Saccharomyces cerevisiae</i>.

Human IFNA2 (P01563, 24 a.a. - 188 a.a.) partial recombinant protein expressed in <i>Saccharomyces cerevisiae</i>.