SYVN1 (Human) Recombinant Protein (P01)
  • SYVN1 (Human) Recombinant Protein (P01)

SYVN1 (Human) Recombinant Protein (P01)

Ref: AB-H00084447-P01
SYVN1 (Human) Recombinant Protein (P01)

Información del producto

Human SYVN1 full-length ORF ( NP_757385.1, 1 a.a. - 617 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name SYVN1
Gene Alias HRD1|KIAA1810|MGC40372
Gene Description synovial apoptosis inhibitor 1, synoviolin
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKVMGKVFFGQLRAAEMEHLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHCRIVSLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAILMTMVLTIFIKYVLHSVDLQSENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYLAMRQF
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 84447

Enviar uma mensagem


SYVN1 (Human) Recombinant Protein (P01)

SYVN1 (Human) Recombinant Protein (P01)