TGM1 (Human) Recombinant Protein (P01) View larger

Human TGM1 full-length ORF ( AAH34699, 1 a.a. - 817 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00007051-P01

New product

TGM1 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 2 ug
Gene Name TGM1
Gene Alias ICR2|KTG|LI|LI1|TGASE|TGK
Gene Description transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLSSRSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEIYILFNPWCPEDI
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 7051

More info

Human TGM1 full-length ORF ( AAH34699, 1 a.a. - 817 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human TGM1 full-length ORF ( AAH34699, 1 a.a. - 817 a.a.) recombinant protein with GST-tag at N-terminal.

Human TGM1 full-length ORF ( AAH34699, 1 a.a. - 817 a.a.) recombinant protein with GST-tag at N-terminal.