F3 (Human) Recombinant Protein
  • F3 (Human) Recombinant Protein

F3 (Human) Recombinant Protein

Ref: AB-P9737
F3 (Human) Recombinant Protein

Información del producto

Human F3 (P13726-1, 33 a.a. - 251 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 100 ug
Gene Name F3
Gene Alias CD142|TF|TFA
Gene Description coagulation factor III (thromboplastin, tissue factor)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,Func,SDS-PAGE
Immunogen Prot. Seq SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
Form Lyophilized
Recomended Dilution Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 2152

Enviar uma mensagem


F3 (Human) Recombinant Protein

F3 (Human) Recombinant Protein