TNFSF12 (Human) Recombinant Protein
  • TNFSF12 (Human) Recombinant Protein

TNFSF12 (Human) Recombinant Protein

Ref: AB-P9729
TNFSF12 (Human) Recombinant Protein

Información del producto

Human TNFSF12 (O43508-1, 43 a.a. - 249 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 100 ug
Gene Name TNFSF12
Gene Alias APO3L|DR3LG|MGC129581|MGC20669|TWEAK
Gene Description tumor necrosis factor (ligand) superfamily, member 12
Storage Conditions Store at -80C for 12 Month.
Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,Func,SDS-PAGE,SPR
Immunogen Prot. Seq SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Form Liquid
Recomended Dilution Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer In PBS pH 7.4
Gene ID 8742

Enviar uma mensagem


TNFSF12 (Human) Recombinant Protein

TNFSF12 (Human) Recombinant Protein