GPC3 (Human) Recombinant Protein View larger

Human GPC3 (P51654-1, 438 a.a. - 554 a.a.) partial recombinant protein expressed in HEK293 cells.

AB-P9727

New product

GPC3 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 17 pontos de fidelização. Seu carrinho totalizará 17 pontos de fidelização que podem ser convertidos num vale de desconto de 68.00EUR.


Data sheet

Size 100 ug
Gene Name GPC3
Gene Alias DGSX|OCI-5|SDYS|SGB|SGBS|SGBS1
Gene Description glypican 3
Storage Conditions Store at -80ºC for 12 Month.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq RNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHN
Form Liquid
Recomended Dilution Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC
Storage Buffer In PBS pH 7.4
Gene ID 2719

More info

Human GPC3 (P51654-1, 438 a.a. - 554 a.a.) partial recombinant protein expressed in HEK293 cells.

Enviar uma mensagem

Human GPC3 (P51654-1, 438 a.a. - 554 a.a.) partial recombinant protein expressed in HEK293 cells.

Human GPC3 (P51654-1, 438 a.a. - 554 a.a.) partial recombinant protein expressed in HEK293 cells.