IL21R (Human) Recombinant Protein View larger

Human IL21R (Q9HBE5, 20 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

AB-P9720

New product

IL21R (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 100 ug
Gene Name IL21R
Gene Alias MGC10967|NILR
Gene Description interleukin 21 receptor
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKE
Form Lyophilized
Recomended Dilution Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 50615

More info

Human IL21R (Q9HBE5, 20 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

Enviar uma mensagem

Human IL21R (Q9HBE5, 20 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

Human IL21R (Q9HBE5, 20 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.