CCR8 (Human) Recombinant Protein
  • CCR8 (Human) Recombinant Protein

CCR8 (Human) Recombinant Protein

Ref: AB-P9718
CCR8 (Human) Recombinant Protein

Información del producto

Human CCR8 (P51685-1, 1 a.a. - 35 a.a.) partial recombinant protein with mFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 100 ug
Gene Name CCR8
Gene Alias CDw198|CKR-L1|CKRL1|CMKBR8|CMKBRL2|CY6|GPR-CY6|MGC129966|MGC129973|TER1
Gene Description chemokine (C-C motif) receptor 8
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,Func,SDS-PAGE
Immunogen Prot. Seq MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK
Form Lyophilized
Recomended Dilution Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 1237

Enviar uma mensagem


CCR8 (Human) Recombinant Protein

CCR8 (Human) Recombinant Protein