DKK1 (Human) Recombinant Protein
  • DKK1 (Human) Recombinant Protein

DKK1 (Human) Recombinant Protein

Ref: AB-P9703
DKK1 (Human) Recombinant Protein

Información del producto

Human DKK1 (O94907, 32 a.a. - 266 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 100 ug
Gene Name DKK1
Gene Alias DKK-1|SK
Gene Description dickkopf homolog 1 (Xenopus laevis)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,Func,SDS-PAGE
Immunogen Prot. Seq TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Form Lyophilized
Recomended Dilution Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 22943

Enviar uma mensagem


DKK1 (Human) Recombinant Protein

DKK1 (Human) Recombinant Protein