TNFRSF8 (Human) Recombinant Protein
  • TNFRSF8 (Human) Recombinant Protein

TNFRSF8 (Human) Recombinant Protein

Ref: AB-P9688
TNFRSF8 (Human) Recombinant Protein

Información del producto

Human TNFRSF8 (P28908, 19 a.a. - 379a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name TNFRSF8
Gene Alias CD30|D1S166E|KI-1
Gene Description tumor necrosis factor receptor superfamily, member 8
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYL
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.15 M NaCl and 10% glycerol)
Gene ID 943

Enviar uma mensagem


TNFRSF8 (Human) Recombinant Protein

TNFRSF8 (Human) Recombinant Protein