View larger
Human CD274 (Q9NZQ7, 19 a.a. - 238 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.
AB-P9681
New product
CD274 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | CD274 |
| Gene Alias | B7-H|B7H1|MGC142294|MGC142296|PD-L1|PDCD1L1|PDCD1LG1|PDL1 |
| Gene Description | CD274 molecule |
| Storage Conditions | Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ADLFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 29126 |
More info
Human CD274 (Q9NZQ7, 19 a.a. - 238 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.