CD164 (Human) Recombinant Protein
  • CD164 (Human) Recombinant Protein

CD164 (Human) Recombinant Protein

Ref: AB-P9667
CD164 (Human) Recombinant Protein

Información del producto

Human CD164 (Q04900, 24 a.a. - 162 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name CD164
Gene Alias MGC-24|MUC-24|endolyn
Gene Description CD164 molecule, sialomucin
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 8763

Enviar uma mensagem


CD164 (Human) Recombinant Protein

CD164 (Human) Recombinant Protein