CD28 (Human) Recombinant Protein
  • CD28 (Human) Recombinant Protein

CD28 (Human) Recombinant Protein

Ref: AB-P9663
CD28 (Human) Recombinant Protein

Información del producto

Human CD28 (P10747, 19 a.a. - 152 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name CD28
Gene Alias MGC138290|Tp44
Gene Description CD28 molecule
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 940

Enviar uma mensagem


CD28 (Human) Recombinant Protein

CD28 (Human) Recombinant Protein