FCER2 (Human) Recombinant Protein
  • FCER2 (Human) Recombinant Protein

FCER2 (Human) Recombinant Protein

Ref: AB-P9662
FCER2 (Human) Recombinant Protein

Información del producto

Human FCER2 (P06734, 48 a.a. - 321 a.a.)partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name FCER2
Gene Alias CD23|CD23A|CLEC4J|FCE2|IGEBF
Gene Description Fc fragment of IgE, low affinity II, receptor for (CD23)
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAES
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 2208

Enviar uma mensagem


FCER2 (Human) Recombinant Protein

FCER2 (Human) Recombinant Protein