BTLA (Human) Recombinant Protein
  • BTLA (Human) Recombinant Protein

BTLA (Human) Recombinant Protein

Ref: AB-P9653
BTLA (Human) Recombinant Protein

Información del producto

Human BTLA (Q7Z6A9, 31 a.a. - 157 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name BTLA
Gene Alias BTLA1|CD272|FLJ16065|MGC129743
Gene Description B and T lymphocyte associated
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYSHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 151888

Enviar uma mensagem


BTLA (Human) Recombinant Protein

BTLA (Human) Recombinant Protein