CD8B (Human) Recombinant Protein View larger

Human CD8B (P10966, 22 a.a. - 170 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.

AB-P9652

New product

CD8B (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name CD8B
Gene Alias CD8B1|LYT3|Leu2|Ly3|MGC119115
Gene Description CD8b molecule
Storage Conditions Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol)
Gene ID 926

More info

Human CD8B (P10966, 22 a.a. - 170 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.

Enviar uma mensagem

Human CD8B (P10966, 22 a.a. - 170 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.

Human CD8B (P10966, 22 a.a. - 170 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.