CD5 (Human) Recombinant Protein View larger

Human CD5 (P06127, 25 a.a. - 372 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</

AB-P9643

New product

CD5 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name CD5
Gene Alias LEU1|T1
Gene Description CD5 molecule
Storage Conditions Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKP
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol)
Gene ID 921

More info

Human CD5 (P06127, 25 a.a. - 372 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Enviar uma mensagem

Human CD5 (P06127, 25 a.a. - 372 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</

Human CD5 (P06127, 25 a.a. - 372 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</