CD5 (Human) Recombinant Protein
  • CD5 (Human) Recombinant Protein

CD5 (Human) Recombinant Protein

Ref: AB-P9643
CD5 (Human) Recombinant Protein

Información del producto

Human CD5 (P06127, 25 a.a. - 372 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CD5
Gene Alias LEU1|T1
Gene Description CD5 molecule
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKP
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (0.4 M Urea and 10% glycerol)
Gene ID 921

Enviar uma mensagem


CD5 (Human) Recombinant Protein

CD5 (Human) Recombinant Protein