CD3D (Human) Recombinant Protein View larger

Human CD3D (P04234, 22 a.a. - 105 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.

AB-P9639

New product

CD3D (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name CD3D
Gene Alias CD3-DELTA|T3D
Gene Description CD3d molecule, delta (CD3-TCR complex)
Storage Conditions Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVALEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 915

More info

Human CD3D (P04234, 22 a.a. - 105 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.

Enviar uma mensagem

Human CD3D (P04234, 22 a.a. - 105 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.

Human CD3D (P04234, 22 a.a. - 105 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.