CD1B (Human) Recombinant Protein
  • CD1B (Human) Recombinant Protein

CD1B (Human) Recombinant Protein

Ref: AB-P9633
CD1B (Human) Recombinant Protein

Información del producto

Human CD1B (P29016, 18 a.a. - 303 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name CD1B
Gene Alias CD1|CD1A|MGC125990|MGC125991|R1
Gene Description CD1b molecule
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGT
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.2 M NaCl and 20% glycerol)
Gene ID 910

Enviar uma mensagem


CD1B (Human) Recombinant Protein

CD1B (Human) Recombinant Protein