View larger
Human CCDC25 (Q86WR0 , 1 a.a. - 208 a.a.) full recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</
AB-P9618
New product
CCDC25 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CCDC25 |
| Gene Alias | FLJ10853 |
| Gene Description | coiled-coil domain containing 25 |
| Storage Conditions | Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMVFYFTSSSVNSSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGENIEDIPKEVLMDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.15 M NaCl and 20% glycerol) |
| Gene ID | 55246 |
More info
Human CCDC25 (Q86WR0 , 1 a.a. - 208 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.