View larger
Human BCDIN3D (Q7Z5W3, 1 a.a. - 292 a.a.) full recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</
AB-P9616
New product
BCDIN3D (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | BCDIN3D |
| Gene Alias | - |
| Gene Description | BCDIN3 domain containing |
| Storage Conditions | Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPN |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.2 M NaCl, 2 mM EDTA and 40% glycerol) |
| Gene ID | 144233 |
More info
Human BCDIN3D (Q7Z5W3, 1 a.a. - 292 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.