CDK5 (Human) Recombinant Protein
  • CDK5 (Human) Recombinant Protein

CDK5 (Human) Recombinant Protein

Ref: AB-P9608
CDK5 (Human) Recombinant Protein

Información del producto

Human CDK5 (Q00535, 1 a.a. - 292 a.a.) full recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name CDK5
Gene Alias PSSALRE
Gene Description cyclin-dependent kinase 5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKL
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (40% glycerol)
Gene ID 1020

Enviar uma mensagem


CDK5 (Human) Recombinant Protein

CDK5 (Human) Recombinant Protein