View larger
Human CDK4 (P11802, 1 a.a. - 303 a.a.) full recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</i>.
AB-P9606
New product
CDK4 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | CDK4 |
| Gene Alias | CMM3|MGC14458|PSK-J3 |
| Gene Description | cyclin-dependent kinase 4 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGL |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 10mM Bis-Tris Propane pH9.0 (50% Glycerol) |
| Gene ID | 1019 |
More info
Human CDK4 (P11802, 1 a.a. - 303 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.