CDK4 (Human) Recombinant Protein
  • CDK4 (Human) Recombinant Protein

CDK4 (Human) Recombinant Protein

Ref: AB-P9606
CDK4 (Human) Recombinant Protein

Información del producto

Human CDK4 (P11802, 1 a.a. - 303 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name CDK4
Gene Alias CMM3|MGC14458|PSK-J3
Gene Description cyclin-dependent kinase 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGL
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 10mM Bis-Tris Propane pH9.0 (50% Glycerol)
Gene ID 1019

Enviar uma mensagem


CDK4 (Human) Recombinant Protein

CDK4 (Human) Recombinant Protein