CDK2AP1 (Human) Recombinant Protein
  • CDK2AP1 (Human) Recombinant Protein

CDK2AP1 (Human) Recombinant Protein

Ref: AB-P9599
CDK2AP1 (Human) Recombinant Protein

Información del producto

Human CDK2AP1 (O14519, 1 a.a. - 115 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name CDK2AP1
Gene Alias DOC1|DORC1|ST19|doc-1|p12DOC-1
Gene Description cyclin-dependent kinase 2 associated protein 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq RGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (0.1 M NaCl and 10% glycerol)
Gene ID 8099

Enviar uma mensagem


CDK2AP1 (Human) Recombinant Protein

CDK2AP1 (Human) Recombinant Protein