CDK2AP1 (Human) Recombinant Protein View larger

Human CDK2AP1 (O14519, 1 a.a. - 115 a.a.) full recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</

AB-P9599

New product

CDK2AP1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 25 ug
Gene Name CDK2AP1
Gene Alias DOC1|DORC1|ST19|doc-1|p12DOC-1
Gene Description cyclin-dependent kinase 2 associated protein 1
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq RGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (0.1 M NaCl and 10% glycerol)
Gene ID 8099

More info

Human CDK2AP1 (O14519, 1 a.a. - 115 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Enviar uma mensagem

Human CDK2AP1 (O14519, 1 a.a. - 115 a.a.) full recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</

Human CDK2AP1 (O14519, 1 a.a. - 115 a.a.) full recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</