View larger
Human FTCD (O95954, 1 a.a. - 541 a.a.) full recombinant protein with His tag at N-terminus expressed in Sf9 cells.
AB-P9596
New product
FTCD (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | FTCD |
| Gene Alias | LCHC1 |
| Gene Description | formiminotransferase cyclodeaminase |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MHHHHHHMSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHT |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 16mM HEPES buffer pH 7.6 (240 mM NaCl and 20% glycerol) |
| Gene ID | 10841 |
More info
Human FTCD (O95954, 1 a.a. - 541 a.a.) full recombinant protein with His tag at N-terminus expressed in Sf9 cells.