CCL5 (Rhesus Macaque) Recombinant Protein
  • CCL5 (Rhesus Macaque) Recombinant Protein

CCL5 (Rhesus Macaque) Recombinant Protein

Ref: AB-P9568
CCL5 (Rhesus Macaque) Recombinant Protein

Información del producto

Rhesus Macaque CCL5 (Q8HYQ1, 24 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL5
Gene Alias -
Gene Description chemokine (C-C motif) ligand 5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPHASDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 574178

Enviar uma mensagem


CCL5 (Rhesus Macaque) Recombinant Protein

CCL5 (Rhesus Macaque) Recombinant Protein