Ccl5 (Mouse) Recombinant Protein
  • Ccl5 (Mouse) Recombinant Protein

Ccl5 (Mouse) Recombinant Protein

Ref: AB-P9566
Ccl5 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl5 (P30882, 24 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl5
Gene Alias MuRantes|RANTES|SISd|Scya5|TCP228
Gene Description chemokine (C-C motif) ligand 5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 20304

Enviar uma mensagem


Ccl5 (Mouse) Recombinant Protein

Ccl5 (Mouse) Recombinant Protein