PF4V1 (Human) Recombinant Protein
  • PF4V1 (Human) Recombinant Protein

PF4V1 (Human) Recombinant Protein

Ref: AB-P9563
PF4V1 (Human) Recombinant Protein

Información del producto

Human PF4V1 (P10720, 31 a.a. - 104 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name PF4V1
Gene Alias CXCL4L1|CXCL4V1|PF4-ALT|PF4A|SCYB4V1
Gene Description platelet factor 4 variant 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (0.2 M NaCl, 1 mM DTT and 50% glycerol)
Gene ID 5197

Enviar uma mensagem


PF4V1 (Human) Recombinant Protein

PF4V1 (Human) Recombinant Protein