Pf4 (Mouse) Recombinant Protein
  • Pf4 (Mouse) Recombinant Protein

Pf4 (Mouse) Recombinant Protein

Ref: AB-P9561
Pf4 (Mouse) Recombinant Protein

Información del producto

Mouse Pf4 (Q9Z126, 30 a.a. - 105 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Pf4
Gene Alias Cxcl4|Scyb4
Gene Description platelet factor 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 56744

Enviar uma mensagem


Pf4 (Mouse) Recombinant Protein

Pf4 (Mouse) Recombinant Protein