PF4 (Human) Recombinant Protein
  • PF4 (Human) Recombinant Protein

PF4 (Human) Recombinant Protein

Ref: AB-P9558
PF4 (Human) Recombinant Protein

Información del producto

Human PF4 (P02776, 32 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name PF4
Gene Alias CXCL4|MGC138298|SCYB4
Gene Description platelet factor 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLY
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 5196

Enviar uma mensagem


PF4 (Human) Recombinant Protein

PF4 (Human) Recombinant Protein