Ppbp (Rat) Recombinant Protein
  • Ppbp (Rat) Recombinant Protein

Ppbp (Rat) Recombinant Protein

Ref: AB-P9556
Ppbp (Rat) Recombinant Protein

Información del producto

Rat Ppbp (Q99ME0, 46 a.a. - 111 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Ppbp
Gene Alias Cxcl7|Nap-2
Gene Description pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 246358

Enviar uma mensagem


Ppbp (Rat) Recombinant Protein

Ppbp (Rat) Recombinant Protein