CCL15 (Human) Recombinant Protein
  • CCL15 (Human) Recombinant Protein

CCL15 (Human) Recombinant Protein

Ref: AB-P9553
CCL15 (Human) Recombinant Protein

Información del producto

Human CCL15 (Q16663, 46 a.a. - 113 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name CCL15
Gene Alias HCC-2|HMRP-2B|LKN1|Lkn-1|MIP-1d|MIP-5|NCC-3|NCC3|SCYA15|SCYL3|SY15
Gene Description chemokine (C-C motif) ligand 15
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 6359

Enviar uma mensagem


CCL15 (Human) Recombinant Protein

CCL15 (Human) Recombinant Protein