Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CCL15 (Human) Recombinant Protein
Abnova
CCL15 (Human) Recombinant Protein
Ref: AB-P9552
CCL15 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human CCL15 (Q16663, 22 a.a. - 113 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
25 ug
Gene Name
CCL15
Gene Alias
HCC-2|HMRP-2B|LKN1|Lkn-1|MIP-1d|MIP-5|NCC-3|NCC3|SCYA15|SCYL3|SY15
Gene Description
chemokine (C-C motif) ligand 15
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
QFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Form
Lyophilized
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer
Lyophilized from sterile distilled Water is >
Gene ID
6359
Enviar uma mensagem
CCL15 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*