Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
CCL18 (Human) Recombinant Protein
Abnova
CCL18 (Human) Recombinant Protein
Ref: AB-P9551
CCL18 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human CCL18 (P55774, 22 a.a. - 89 a.a.) partial recombinant protein with His tag at N-terminus expressed in
Escherichia coli
.
Información adicional
Size
5 ug
Gene Name
CCL18
Gene Alias
AMAC-1|AMAC1|CKb7|DC-CK1|DCCK1|MIP-4|PARC|SCYA18
Gene Description
chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSHMQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Form
Liquid
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer
In 10 mM Sodium Citrate buffer pH3.5 (10% glycerol)
Gene ID
6362
Enviar uma mensagem
CCL18 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*