Ccl20 (Mouse) Recombinant Protein
  • Ccl20 (Mouse) Recombinant Protein

Ccl20 (Mouse) Recombinant Protein

Ref: AB-P9549
Ccl20 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl20 (O89093, 28 a.a. - 97 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl20
Gene Alias CKb4|LARC|MIP-3A|MIP-3[a]|MIP3A|ST38|Scya20|exodus-1
Gene Description chemokine (C-C motif) ligand 20
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 20297

Enviar uma mensagem


Ccl20 (Mouse) Recombinant Protein

Ccl20 (Mouse) Recombinant Protein