CCL20 (Human) Recombinant Protein
  • CCL20 (Human) Recombinant Protein

CCL20 (Human) Recombinant Protein

Ref: AB-P9548
CCL20 (Human) Recombinant Protein

Información del producto

Human CCL20 (P78556 27 a.a. - 96 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name CCL20
Gene Alias CKb4|LARC|MIP-3a|MIP3A|SCYA20|ST38
Gene Description chemokine (C-C motif) ligand 20
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 6364

Enviar uma mensagem


CCL20 (Human) Recombinant Protein

CCL20 (Human) Recombinant Protein