CCL20 (Human) Recombinant Protein View larger

Human CCL20 (P78556 27 a.a. - 96 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</

AB-P9548

New product

CCL20 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name CCL20
Gene Alias CKb4|LARC|MIP-3a|MIP3A|SCYA20|ST38
Gene Description chemokine (C-C motif) ligand 20
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 6364

More info

Human CCL20 (P78556 27 a.a. - 96 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Enviar uma mensagem

Human CCL20 (P78556 27 a.a. - 96 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</

Human CCL20 (P78556 27 a.a. - 96 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</