Ccl4 (Rat) Recombinant Protein View larger

Rat Ccl4 (P50230, 24 a.a. - 92 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P9541

New product

Ccl4 (Rat) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name Ccl4
Gene Alias Mip1-b|Scya4
Gene Description chemokine (C-C motif) ligand 4
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 116637

More info

Rat Ccl4 (P50230, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Rat Ccl4 (P50230, 24 a.a. - 92 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Rat Ccl4 (P50230, 24 a.a. - 92 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.