Ccl4 (Mouse) Recombinant Protein
  • Ccl4 (Mouse) Recombinant Protein

Ccl4 (Mouse) Recombinant Protein

Ref: AB-P9540
Ccl4 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl4 (P14097, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Ccl4
Gene Alias AT744.1|Act-2|MIP-1B|Mip1b|Scya4
Gene Description chemokine (C-C motif) ligand 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 20303

Enviar uma mensagem


Ccl4 (Mouse) Recombinant Protein

Ccl4 (Mouse) Recombinant Protein