Ccl3 (Rat) Recombinant Protein
  • Ccl3 (Rat) Recombinant Protein

Ccl3 (Rat) Recombinant Protein

Ref: AB-P9538
Ccl3 (Rat) Recombinant Protein

Información del producto

Rat Ccl3 (P50229, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl3
Gene Alias MIP-1a|Scya3
Gene Description chemokine (C-C motif) ligand 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 25542

Enviar uma mensagem


Ccl3 (Rat) Recombinant Protein

Ccl3 (Rat) Recombinant Protein