Cxcl9 (Mouse) Recombinant Protein
  • Cxcl9 (Mouse) Recombinant Protein

Cxcl9 (Mouse) Recombinant Protein

Ref: AB-P9532
Cxcl9 (Mouse) Recombinant Protein

Información del producto

Mouse Cxcl9 (P18340, 22 a.a. - 126 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Cxcl9
Gene Alias BB139920|CMK|Mig|Scyb9|crg-10
Gene Description chemokine (C-X-C motif) ligand 9
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 17329

Enviar uma mensagem


Cxcl9 (Mouse) Recombinant Protein

Cxcl9 (Mouse) Recombinant Protein