View larger
Human CCL28 (Q9NRJ3, 23 a.a. - 127 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli
AB-P9527
New product
CCL28 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CCL28 |
| Gene Alias | CCK1|MEC|MGC71902|SCYA28 |
| Gene Description | chemokine (C-C motif) ligand 28 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 10mM Sodium citrate pH 3.5 (10% glycerol) |
| Gene ID | 56477 |
More info
Human CCL28 (Q9NRJ3, 23 a.a. - 127 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.