Ccl2 (Rat) Recombinant Protein View larger

Rat Ccl2 (P14844, 24 a.a. - 148 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P9511

New product

Ccl2 (Rat) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name Ccl2
Gene Alias MCP-1|Scya2|Sigje
Gene Description chemokine (C-C motif) ligand 2
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 24770

More info

Rat Ccl2 (P14844, 24 a.a. - 148 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Rat Ccl2 (P14844, 24 a.a. - 148 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Rat Ccl2 (P14844, 24 a.a. - 148 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.