View larger
Mouse Ccl2 (P10148, 24 a.a. - 148 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli<
AB-P9510
New product
Ccl2 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | Ccl2 |
| Gene Alias | AI323594|HC11|JE|MCAF|MCP-1|MCP1|SMC-CF|Scya2|Sigje |
| Gene Description | chemokine (C-C motif) ligand 2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 20296 |
More info
Mouse Ccl2 (P10148, 24 a.a. - 148 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.