Ccl2 (Mouse) Recombinant Protein
  • Ccl2 (Mouse) Recombinant Protein

Ccl2 (Mouse) Recombinant Protein

Ref: AB-P9510
Ccl2 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl2 (P10148, 24 a.a. - 148 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl2
Gene Alias AI323594|HC11|JE|MCAF|MCP-1|MCP1|SMC-CF|Scya2|Sigje
Gene Description chemokine (C-C motif) ligand 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 20296

Enviar uma mensagem


Ccl2 (Mouse) Recombinant Protein

Ccl2 (Mouse) Recombinant Protein