CCL4L1 (Human) Recombinant Protein
  • CCL4L1 (Human) Recombinant Protein

CCL4L1 (Human) Recombinant Protein

Ref: AB-P9498
CCL4L1 (Human) Recombinant Protein

Información del producto

Human CCL4L1 (Q8NHW4, 24 a.a. - 92 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL4L2
Gene Alias AT744.2|CCL4L|SCYA4L
Gene Description chemokine (C-C motif) ligand 4-like 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 10mM Sodium citrate pH 3.5 (10% glycerol)
Gene ID 388372

Enviar uma mensagem


CCL4L1 (Human) Recombinant Protein

CCL4L1 (Human) Recombinant Protein