CCL14 (Human) Recombinant Protein
  • CCL14 (Human) Recombinant Protein

CCL14 (Human) Recombinant Protein

Ref: AB-P9475
CCL14 (Human) Recombinant Protein

Información del producto

Human CCL14 (Q16627, 22 a.a. - 93 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name CCL14
Gene Alias CC-1|CC-3|CKb1|HCC-1|HCC-3|MCIF|NCC-2|NCC2|SCYA14|SCYL2|SY14
Gene Description chemokine (C-C motif) ligand 14
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHS_x005F_x005F_x005F_x000D__x005F_x000D__x000D_VCTNPSDKWVQDYIKDMKEN
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 6358

Enviar uma mensagem


CCL14 (Human) Recombinant Protein

CCL14 (Human) Recombinant Protein