View larger
Human CXCL1 (P09341, 35 a.a. - 107 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P9459
New product
CXCL1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | CXCL1 |
| Gene Alias | FSP|GRO1|GROa|MGSA|MGSA-a|NAP-3|SCYB1 |
| Gene Description | chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 2919 |
More info
Human CXCL1 (P09341, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli.