Cx3cl1 (Mouse) Recombinant Protein
  • Cx3cl1 (Mouse) Recombinant Protein

Cx3cl1 (Mouse) Recombinant Protein

Ref: AB-P9456
Cx3cl1 (Mouse) Recombinant Protein

Información del producto

Mouse Cx3cl1 (O35188, 25 a.a. - 100 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Cx3cl1
Gene Alias AB030188|ABCD-3|AI848747|CX3C|Cxc3|D8Bwg0439e|Scyd1
Gene Description chemokine (C-X3-C motif) ligand 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNG
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 20312

Enviar uma mensagem


Cx3cl1 (Mouse) Recombinant Protein

Cx3cl1 (Mouse) Recombinant Protein